PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G196400.3
Common NameB456_011G196400, LOC105776456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 594aa    MW: 65149.9 Da    PI: 6.5163
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G196400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.9e-29126179155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Gorai.011G196400.3 126 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 179
                         79*******************.********************************8 PP

2Response_reg32.25.6e-1215653109
                         CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
        Response_reg  53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                         mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  Ga d+l Kp+ +e+l +
  Gorai.011G196400.3   1 MPDMDGFKLLEHIGLEM-DLPVIMMSADDGKQVVMKGVTHGACDYLIKPVRIEALKN 56 
                         9************6654.8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521728.97E-16170IPR011006CheY-like superfamily
PfamPF000726.1E-9156IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.57E-12161No hitNo description
PIRSFPIRSF0363929.2E-1341585IPR017053Response regulator B-type, plant
PROSITE profilePS5011024.433162IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.0E-20188No hitNo description
SuperFamilySSF466893.05E-20123183IPR009057Homeodomain-like
PROSITE profilePS5129411.048123182IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-30125184IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-25126179IPR006447Myb domain, plants
PfamPF002498.2E-8128178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MPDMDGFKLL EHIGLEMDLP VIMMSADDGK QVVMKGVTHG ACDYLIKPVR IEALKNIWQH  60
VVRKRKNEWK EFEQSGSVEE GDRQPKQSDD ADYSSSANEG NWKGSKRRKD EEEETDERDD  120
TSTLKKPRVV WSVELHQQFV AAVNQLGIDK AVPKKILELM NVPGLTRENV ASHLQKYRLY  180
LRRLSGVSQH QSNLSTIISA QDPTFGSLSS LSGLDLQTLA ATGQLPAQSL ARLQAAGLGR  240
ATAKSGIPIT LVDQRNIFSF ENPKLRFGEG QQQHMTNKQQ VNLLHGIPTT MEAKQLVSLR  300
HAAQSVGNMN MQVPPPGPQS SQNNPLLMQM GQQQQQQQSR GQILVDSTIN HAPRLSSMGQ  360
PILSNGMATN VSSRNGIPEN IRAPGYSQTP SMLNFPMNHA SELPGNCFPL GSTPGVSNLT  420
SKGAFQEDVN SEIKGSGGFM PSYDVFNDLN QHKPQSWELQ NVGIAFDSSQ HSNSLQGNLD  480
LTQSALGQQG FSSGQMNGHN RSAAVASKAV FSTGDVKELR SAQNVNQHLN NLLVDNTIRV  540
KSERVCDTSP ANIFPDHFGQ DDLMSALLKQ QESVASSENE FDFDGYSMNN IPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-22125185464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3934659e-85GQ393465.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0430 SSR marker CGR5416 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454564.10.0PREDICTED: two-component response regulator ARR2-like isoform X1
SwissprotQ9ZWJ91e-175ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A0D2UVE10.0A0A0D2UVE1_G
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.21e-140response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]